PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10028744m
Common NameCICLE_v10028745mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family B3
Protein Properties Length: 350aa    MW: 40414.3 Da    PI: 9.2165
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10028744mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.56.8e-1520991093
                     HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
               B3 10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93
                     + + + + +p +f+ ++g +   s   tl++++g +++v +  ++k+g +++ +GW+eFv+++ +++g fv+F++ ++s+f+ +
  Ciclev10028744m 20 TIEDKKMKIPQNFVGRFGDE--LSNVATLTNPEGYVMRVGI--TRKDGNIWFDGGWNEFVEDHSIDVGYFVLFQYRKNSKFRVF 99
                     4566779*******999855..8889***************..********************************999999544 PP

2B347.53.3e-15260347497
                      E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
               B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      v++++++++++ +++p +fa+++ + +e+   +t++d++gr+  vk+  ++++++y+lt  W +F k  ++kegD++ F++++ ++  l+v+vf
  Ciclev10028744m 260 VFLRASNMQLNYVYVPTSFARKYLNGEEC---VTVQDSDGRKLAVKV--KQSRRKYLLT-RWGKFFKKTNVKEGDILFFEMIQMKKILLKVSVF 347
                      566788999999***********544556...***************..9999999999.9*******************99877777778777 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.4E-214105IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.65E-215106IPR015300DNA-binding pseudobarrel domain
CDDcd100174.27E-1210102No hitNo description
PROSITE profilePS5086312.23811104IPR003340B3 DNA binding domain
SMARTSM010191.9E-812104IPR003340B3 DNA binding domain
PfamPF023623.7E-1220100IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-16251348IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-16253347IPR015300DNA-binding pseudobarrel domain
CDDcd100178.35E-13256348No hitNo description
PROSITE profilePS5086310.052257349IPR003340B3 DNA binding domain
SMARTSM010194.9E-4258348IPR003340B3 DNA binding domain
PfamPF023625.5E-14260348IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MPSSMKKTYP HFIDVILDST IEDKKMKIPQ NFVGRFGDEL SNVATLTNPE GYVMRVGITR  60
KDGNIWFDGG WNEFVEDHSI DVGYFVLFQY RKNSKFRVFI YNTTTCEIQY PSRNTFPPPR  120
QNQATFDGSK SKNGCEMRGK TYRMEEVKVK EESDNVNDSM QDVIGTCNSE GSVHAKIHLS  180
ETQCSSVQET DLKIDSTKFK KAKHNLKDEL RADSVDRVKL FALLEDMDIH ICESRMTLEE  240
RQEAINVARL LKPEKPSFLV FLRASNMQLN YVYVPTSFAR KYLNGEECVT VQDSDGRKLA  300
VKVKQSRRKY LLTRWGKFFK KTNVKEGDIL FFEMIQMKKI LLKVSVFNA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006423121.10.0hypothetical protein CICLE_v10028745mg
RefseqXP_006423122.10.0hypothetical protein CICLE_v10028745mg
RefseqXP_006423123.10.0hypothetical protein CICLE_v10028745mg
RefseqXP_006479377.10.0PREDICTED: B3 domain-containing transcription factor VRN1
RefseqXP_006479378.10.0PREDICTED: B3 domain-containing transcription factor VRN1
RefseqXP_006479379.10.0PREDICTED: B3 domain-containing transcription factor VRN1
RefseqXP_015386267.10.0PREDICTED: B3 domain-containing transcription factor VRN1
TrEMBLV4SH650.0V4SH65_9R
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.15e-44B3 family protein